Lineage for d2dxya1 (2dxy A:342-685)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710610Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 710611Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 711143Family c.94.1.2: Transferrin [53888] (3 proteins)
    further duplication: composed of two two-domain lobes
  6. 711144Protein Lactoferrin [53889] (6 species)
  7. 711150Species Cow (Bos taurus) [TaxId:9913] [53891] (36 PDB entries)
  8. 711158Domain d2dxya1: 2dxy A:342-685 [131879]
    automatically matched to d1nkxa_
    complexed with bma, co3, fe, man, nag, so4, tre, zn

Details for d2dxya1

PDB Entry: 2dxy (more details), 2.03 Å

PDB Description: structure of the complex of c-terminal lobe of bovine lactoferrin with trehalose at 2.0 a resolution
PDB Compounds: (A:) lactotransferrin

SCOP Domain Sequences for d2dxya1:

Sequence, based on SEQRES records: (download)

>d2dxya1 c.94.1.2 (A:342-685) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcstsplleaca

Sequence, based on observed residues (ATOM records): (download)

>d2dxya1 c.94.1.2 (A:342-685) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcsleaca

SCOP Domain Coordinates for d2dxya1:

Click to download the PDB-style file with coordinates for d2dxya1.
(The format of our PDB-style files is described here.)

Timeline for d2dxya1: