Lineage for d2dxfb_ (2dxf B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1204903Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1204904Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1204905Protein Nucleoside diphosphate kinase, NDK [54921] (21 species)
  7. 1205045Species Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries)
    Uniprot O58429 3-155
  8. 1205051Domain d2dxfb_: 2dxf B: [131873]
    automated match to d2cwka1
    complexed with cl, gnp

Details for d2dxfb_

PDB Entry: 2dxf (more details), 1.7 Å

PDB Description: Crystal structure of nucleoside diphosphate kinase in complex with GTP analog
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d2dxfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dxfb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Pyrococcus horikoshii [TaxId: 53953]}
setertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpff
kalidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnvih
asdskesaereislffkpeelfeypraadwfykk

SCOPe Domain Coordinates for d2dxfb_:

Click to download the PDB-style file with coordinates for d2dxfb_.
(The format of our PDB-style files is described here.)

Timeline for d2dxfb_: