| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
| Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) |
| Species Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries) Uniprot O58429 3-155 |
| Domain d2dxfb_: 2dxf B: [131873] automated match to d2cwka1 complexed with cl, gnp |
PDB Entry: 2dxf (more details), 1.7 Å
SCOPe Domain Sequences for d2dxfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dxfb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Pyrococcus horikoshii [TaxId: 53953]}
setertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpff
kalidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnvih
asdskesaereislffkpeelfeypraadwfykk
Timeline for d2dxfb_: