SCOPe 2.01: Domain d2dxeb_: 2dxe B:

Lineage for d2dxeb_ (2dxe B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (21 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries)
   Uniprot O58429 3-155

8. Domain d2dxeb_: 2dxe B: [131871]
   automated match to d2cwka1
   complexed with cl, gdp, mg

Details for d2dxeb_

PDB Entry: 2dxe, 1.7 Å

PDB Description: Crystal structure of nucleoside diphosphate kinase in complex with GDP

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d2dxeb_:

Sequence; same for both SEQRES and ATOM records:

>d2dxeb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Pyrococcus horikoshii [TaxId: 53953]}
setertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpff
kalidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnvih
asdskesaereislffkpeelfeypraadwfykkgi

Timeline for d2dxeb_:

• d2dxeb_ first appeared in SCOP 1.73, called d2dxeb1
  
• d2dxeb_ was called d2dxeb1 in SCOP 1.75
  
• d2dxeb_ appears in SCOPe 2.02
  
• d2dxeb_ appears in the current release, SCOPe 2.08