Lineage for d2dxeb_ (2dxe B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. Species Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries)
    Uniprot O58429 3-155
  8. Domain d2dxeb_: 2dxe B: [131871]
    automated match to d2cwka1
    complexed with cl, gdp, mg

Details for d2dxeb_

PDB Entry: 2dxe (more details), 1.7 Å

PDB Description: Crystal structure of nucleoside diphosphate kinase in complex with GDP
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d2dxeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dxeb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Pyrococcus horikoshii [TaxId: 53953]}
setertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpff
kalidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnvih
asdskesaereislffkpeelfeypraadwfykkgi

SCOPe Domain Coordinates for d2dxeb_ are not available.

Timeline for d2dxeb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2dxea_