Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein) |
Protein Nucleoside diphosphate kinase, NDK [54921] (20 species) |
Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries) |
Domain d2dxea1: 2dxe A:6-158 [131870] automatically matched to 2CWK A:6-158 complexed with cl, gdp, mg |
PDB Entry: 2dxe (more details), 1.7 Å
SCOP Domain Sequences for d2dxea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dxea1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} etertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffk alidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnviha sdskesaereislffkpeelfeypraadwfykk
Timeline for d2dxea1: