Lineage for d2dxdb_ (2dxd B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557935Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2557936Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2557937Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2558098Species Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries)
    Uniprot O58429 3-155
  8. 2558106Domain d2dxdb_: 2dxd B: [131869]
    automated match to d2cwka1
    complexed with anp, cl

Details for d2dxdb_

PDB Entry: 2dxd (more details), 1.77 Å

PDB Description: crystal structure of nucleoside diphosphate kinase in complex with atp analog
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d2dxdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dxdb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Pyrococcus horikoshii [TaxId: 53953]}
setertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpff
kalidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnvih
asdskesaereislffkpeelfeypraadwfykk

SCOPe Domain Coordinates for d2dxdb_:

Click to download the PDB-style file with coordinates for d2dxdb_.
(The format of our PDB-style files is described here.)

Timeline for d2dxdb_: