SCOP 1.75: Domain d2dxdb1: 2dxd B:6-158

Lineage for d2dxdb1 (2dxd B:6-158)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries)
   Uniprot O58429 3-155

8. Domain d2dxdb1: 2dxd B:6-158 [131869]
   automatically matched to 2CWK A:6-158
   complexed with anp, cl

Details for d2dxdb1

PDB Entry: 2dxd, 1.77 Å

PDB Description: crystal structure of nucleoside diphosphate kinase in complex with atp analog

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOP Domain Sequences for d2dxdb1:

Sequence; same for both SEQRES and ATOM records:

>d2dxdb1 d.58.6.1 (B:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
etertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffk
alidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnviha
sdskesaereislffkpeelfeypraadwfykk

Timeline for d2dxdb1:

• d2dxdb1 first appeared in SCOP 1.73
  
• d2dxdb1 is called d2dxdb_ in SCOPe 2.01
  
• d2dxdb1 appears in the current release, SCOPe 2.08, called d2dxdb_