Lineage for d2dxdb1 (2dxd B:6-158)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724082Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 724083Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 724084Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 724105Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries)
  8. 724113Domain d2dxdb1: 2dxd B:6-158 [131869]
    automatically matched to 2CWK A:6-158
    complexed with anp, cl

Details for d2dxdb1

PDB Entry: 2dxd (more details), 1.77 Å

PDB Description: Crystal structure of nucleoside diphosphate kinase in complex with ATP analog
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOP Domain Sequences for d2dxdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dxdb1 d.58.6.1 (B:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
etertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffk
alidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnviha
sdskesaereislffkpeelfeypraadwfykk

SCOP Domain Coordinates for d2dxdb1:

Click to download the PDB-style file with coordinates for d2dxdb1.
(The format of our PDB-style files is described here.)

Timeline for d2dxdb1: