![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin [54238] (7 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [224919] (28 PDB entries) |
![]() | Domain d2dx5b1: 2dx5 B:1-73 [131867] Other proteins in same PDB: d2dx5a1 automatically matched to d1aara_ |
PDB Entry: 2dx5 (more details), 3.35 Å
SCOPe Domain Sequences for d2dx5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dx5b1 d.15.1.1 (B:1-73) Ubiquitin {Cow (Bos taurus) [TaxId: 9913]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrl
Timeline for d2dx5b1: