Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) contains an additional N-terminal strand |
Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins) consist of a single subdomain automatically mapped to Pfam PF02883 |
Protein automated matches [190194] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187060] (2 PDB entries) |
Domain d2dwyc_: 2dwy C: [131864] automated match to d1om9a_ |
PDB Entry: 2dwy (more details), 2.3 Å
SCOPe Domain Sequences for d2dwyc_:
Sequence, based on SEQRES records: (download)
>d2dwyc_ b.1.10.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ikpsnilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirnivfqsavpk vmkvklqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmgdqtynemgd vdqfpppetwgsl
>d2dwyc_ b.1.10.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ikpsilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirnivfqsavpkv mkvklqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmgdqtynemgdv dqfpppetwgsl
Timeline for d2dwyc_: