Lineage for d2dwyc1 (2dwy C:512-639)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658307Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families) (S)
    contains an additional N-terminal strand
  5. 658328Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (3 proteins)
    consist of a single subdomain
  6. 658329Protein ADP-ribosylation factor binding protein Gga1 domain [89201] (1 species)
  7. 658330Species Human (Homo sapiens) [TaxId:9606] [89202] (4 PDB entries)
  8. 658335Domain d2dwyc1: 2dwy C:512-639 [131864]
    automatically matched to d1om9a_

Details for d2dwyc1

PDB Entry: 2dwy (more details), 2.3 Å

PDB Description: Crystal Structure Analysis of GGA1-GAE
PDB Compounds: (C:) ADP-ribosylation factor binding protein GGA1

SCOP Domain Sequences for d2dwyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dwyc1 b.1.10.2 (C:512-639) ADP-ribosylation factor binding protein Gga1 domain {Human (Homo sapiens) [TaxId: 9606]}
ilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirnivfqsavpkvmkvk
lqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmgdqtynemgdvdqfp
ppetwgsl

SCOP Domain Coordinates for d2dwyc1:

Click to download the PDB-style file with coordinates for d2dwyc1.
(The format of our PDB-style files is described here.)

Timeline for d2dwyc1: