SCOP 1.73: Domain d2dwyb1: 2dwy B:511-636

Lineage for d2dwyb1 (2dwy B:511-636)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families)
   contains an additional N-terminal strand

5. Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (3 proteins)
   consist of a single subdomain

6. Protein ADP-ribosylation factor binding protein Gga1 domain [89201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89202] (4 PDB entries)

8. Domain d2dwyb1: 2dwy B:511-636 [131863]
   automatically matched to d1om9a_

Details for d2dwyb1

PDB Entry: 2dwy, 2.3 Å

PDB Description: Crystal Structure Analysis of GGA1-GAE

PDB Compounds: (B:) ADP-ribosylation factor binding protein GGA1

SCOP Domain Sequences for d2dwyb1:

Sequence; same for both SEQRES and ATOM records:

>d2dwyb1 b.1.10.2 (B:511-636) ADP-ribosylation factor binding protein Gga1 domain {Human (Homo sapiens) [TaxId: 9606]}
nilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirnivfqsavpkvmkv
klqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmgdqtynemgdvdqf
pppetw

Timeline for d2dwyb1:

• d2dwyb1 is new in SCOP 1.73
  
• d2dwyb1 appears in SCOP 1.75
  
• d2dwyb1 appears in the current release, SCOPe 2.08, called d2dwyb_