SCOP 1.73: Domain d2dwxc1: 2dwx C:512-639

Lineage for d2dwxc1 (2dwx C:512-639)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families)
   contains an additional N-terminal strand

5. Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (3 proteins)
   consist of a single subdomain

6. Protein ADP-ribosylation factor binding protein Gga1 domain [89201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89202] (4 PDB entries)

8. Domain d2dwxc1: 2dwx C:512-639 [131860]
   automatically matched to d1om9a_

Details for d2dwxc1

PDB Entry: 2dwx, 2.55 Å

PDB Description: Co-crystal Structure Analysis of GGA1-GAE with the WNSF motif

PDB Compounds: (C:) ADP-ribosylation factor-binding protein GGA1

SCOP Domain Sequences for d2dwxc1:

Sequence; same for both SEQRES and ATOM records:

>d2dwxc1 b.1.10.2 (C:512-639) ADP-ribosylation factor binding protein Gga1 domain {Human (Homo sapiens) [TaxId: 9606]}
ilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirnivfqsavpkvmkvk
lqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmgdqtynemgdvdqfp
ppetwgsl

Timeline for d2dwxc1:

• d2dwxc1 is new in SCOP 1.73
  
• d2dwxc1 appears in SCOP 1.75
  
• d2dwxc1 appears in the current release, SCOPe 2.08, called d2dwxc_