Lineage for d2dwxb_ (2dwx B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764533Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) (S)
    contains an additional N-terminal strand
  5. 2764555Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins)
    consist of a single subdomain
    automatically mapped to Pfam PF02883
  6. 2764573Protein automated matches [190194] (2 species)
    not a true protein
  7. 2764574Species Human (Homo sapiens) [TaxId:9606] [187060] (2 PDB entries)
  8. 2764580Domain d2dwxb_: 2dwx B: [131859]
    automated match to d1om9a_

Details for d2dwxb_

PDB Entry: 2dwx (more details), 2.55 Å

PDB Description: Co-crystal Structure Analysis of GGA1-GAE with the WNSF motif
PDB Compounds: (B:) ADP-ribosylation factor-binding protein GGA1

SCOPe Domain Sequences for d2dwxb_:

Sequence, based on SEQRES records: (download)

>d2dwxb_ b.1.10.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirnivfqsavpkvmkvk
lqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmgdqtynemgdvdqfp
ppetwgsl

Sequence, based on observed residues (ATOM records): (download)

>d2dwxb_ b.1.10.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirnivfqsavvklqpps
gtelpafnpivhpsaitqvlllanpqkerykltftmgdqtynemgdvdqfpppetwgsl

SCOPe Domain Coordinates for d2dwxb_:

Click to download the PDB-style file with coordinates for d2dwxb_.
(The format of our PDB-style files is described here.)

Timeline for d2dwxb_: