Lineage for d2dwta1 (2dwt A:44-193)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660887Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 661004Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 661277Species Rhodobacter sphaeroides [TaxId:1063] [110101] (8 PDB entries)
  8. 661294Domain d2dwta1: 2dwt A:44-193 [131856]
    automatically matched to d1mzya1
    complexed with cu, no2

Details for d2dwta1

PDB Entry: 2dwt (more details), 1.9 Å

PDB Description: cu-containing nitrite reductase at ph 6.0 with bound nitrite
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOP Domain Sequences for d2dwta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dwta1 b.6.1.3 (A:44-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]}
lprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsipgpl
mivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatragaf
vyhcapggpmipwhvvsgmagcimvlprdg

SCOP Domain Coordinates for d2dwta1:

Click to download the PDB-style file with coordinates for d2dwta1.
(The format of our PDB-style files is described here.)

Timeline for d2dwta1:

Domains from same chain:
(mouse over for more information)
d2dwta2