SCOPe 2.08: Domain d2dwta1: 2dwt A:44-198

Lineage for d2dwta1 (2dwt A:44-198)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [419332] (8 PDB entries)
   Uniprot Q53239

8. Domain d2dwta1: 2dwt A:44-198 [131856]
   Other proteins in same PDB: d2dwta2
   automated match to d1kcba1
   complexed with cu, no2

Details for d2dwta1

PDB Entry: 2dwt, 1.9 Å

PDB Description: cu-containing nitrite reductase at ph 6.0 with bound nitrite

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2dwta1:

Sequence; same for both SEQRES and ATOM records:

>d2dwta1 b.6.1.3 (A:44-198) Nitrite reductase, NIR, N-terminal domain {Rhodobacter sphaeroides [TaxId: 1063]}
lprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsipgpl
mivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatragaf
vyhcapggpmipwhvvsgmagcimvlprdglkdhe

Timeline for d2dwta1:

• d2dwta1 first appeared in SCOP 1.73
  
• d2dwta1 appears in SCOPe 2.07