SCOPe 2.07: Domain d2dwsa1: 2dws A:44-193

Lineage for d2dwsa1 (2dws A:44-193)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Rhodobacter sphaeroides [TaxId:1063] [110101] (8 PDB entries)
   Uniprot Q53239

8. Domain d2dwsa1: 2dws A:44-193 [131854]
   automated match to d2dwsa1
   complexed with cu, no2

Details for d2dwsa1

PDB Entry: 2dws, 1.85 Å

PDB Description: cu-containing nitrite reductase at ph 8.4 with bound nitrite

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2dwsa1:

Sequence; same for both SEQRES and ATOM records:

>d2dwsa1 b.6.1.3 (A:44-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]}
lprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsipgpl
mivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatragaf
vyhcapggpmipwhvvsgmagcimvlprdg

Timeline for d2dwsa1:

• d2dwsa1 first appeared in SCOP 1.73
  
• d2dwsa1 appears in SCOPe 2.06
  
• d2dwsa1 appears in the current release, SCOPe 2.08