| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
| Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) |
| Species Rhodobacter sphaeroides [TaxId:1063] [419332] (8 PDB entries) Uniprot Q53239 |
| Domain d2dwsa1: 2dws A:44-193 [131854] Other proteins in same PDB: d2dwsa2 automated match to d2dwsa1 complexed with cu, no2 |
PDB Entry: 2dws (more details), 1.85 Å
SCOPe Domain Sequences for d2dwsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dwsa1 b.6.1.3 (A:44-193) Nitrite reductase, NIR, N-terminal domain {Rhodobacter sphaeroides [TaxId: 1063]}
lprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsipgpl
mivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatragaf
vyhcapggpmipwhvvsgmagcimvlprdg
Timeline for d2dwsa1: