SCOPe 2.07: Domain d2dwec_: 2dwe C:

Lineage for d2dwec_ (2dwe C:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein automated matches [190184] (3 species)
   not a true protein

7. Species Streptomyces lividans [TaxId:1916] [186922] (11 PDB entries)

8. Domain d2dwec_: 2dwe C: [131850]
   Other proteins in same PDB: d2dwea1, d2dwea2, d2dwea3, d2dweb1, d2dweb2
   automated match to d1k4cc_
   complexed with f09, l2c, rb, tba

Details for d2dwec_

PDB Entry: 2dwe, 2.5 Å

PDB Description: crystal structure of kcsa-fab-tba complex in rb+

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2dwec_:

Sequence; same for both SEQRES and ATOM records:

>d2dwec_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d2dwec_:

• d2dwec_ first appeared in SCOP 1.73, called d2dwec1
  
• d2dwec_ appears in SCOPe 2.06
  
• d2dwec_ appears in the current release, SCOPe 2.08