Lineage for d2dwec_ (2dwe C:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1058900Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 1058901Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 1058902Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1058987Protein automated matches [190184] (1 species)
    not a true protein
  7. 1058988Species Streptomyces lividans [TaxId:1916] [186922] (5 PDB entries)
  8. 1058990Domain d2dwec_: 2dwe C: [131850]
    automated match to d1k4cc_
    complexed with f09, l2c, rb, tba

Details for d2dwec_

PDB Entry: 2dwe (more details), 2.5 Å

PDB Description: crystal structure of kcsa-fab-tba complex in rb+
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2dwec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dwec_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d2dwec_:

Click to download the PDB-style file with coordinates for d2dwec_.
(The format of our PDB-style files is described here.)

Timeline for d2dwec_: