SCOP 1.73: Domain d2dwec1: 2dwe C:22-124

Lineage for d2dwec1 (2dwe C:22-124)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)

6. Protein Potassium channel protein [56901] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [56902] (27 PDB entries)
   identical sequence to Streptomyces lividans, TaxId: 1916

8. Domain d2dwec1: 2dwe C:22-124 [131850]
   automatically matched to d1k4cc_
   complexed with f09, l2c, rb, tba; mutant

Details for d2dwec1

PDB Entry: 2dwe, 2.5 Å

PDB Description: crystal structure of kcsa-fab-tba complex in rb+

PDB Compounds: (C:) Voltage-gated potassium channel

SCOP Domain Sequences for d2dwec1:

Sequence; same for both SEQRES and ATOM records:

>d2dwec1 f.14.1.1 (C:22-124) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d2dwec1:

• d2dwec1 is new in SCOP 1.73
  
• d2dwec1 appears in SCOP 1.75
  
• d2dwec1 appears in the current release, SCOPe 2.08, called d2dwec_