![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) ![]() Pfam PF00520 |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
![]() | Protein automated matches [190184] (3 species) not a true protein |
![]() | Species Streptomyces lividans [TaxId:1916] [186922] (11 PDB entries) |
![]() | Domain d2dwec_: 2dwe C: [131850] Other proteins in same PDB: d2dwea1, d2dwea2, d2dwea3, d2dweb1, d2dweb2 automated match to d1k4cc_ complexed with f09, l2c, rb, tba |
PDB Entry: 2dwe (more details), 2.5 Å
SCOPe Domain Sequences for d2dwec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dwec_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d2dwec_: