SCOPe 2.03: Domain d2dwdc_: 2dwd C:

Lineage for d2dwdc_ (2dwd C:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein automated matches [190184] (2 species)
   not a true protein

7. Species Streptomyces lividans [TaxId:1916] [186922] (9 PDB entries)

8. Domain d2dwdc_: 2dwd C: [131849]
   Other proteins in same PDB: d2dwda1, d2dwda2, d2dwdb1, d2dwdb2
   automated match to d1k4cc_
   complexed with f09, l2c, tba, tl

Details for d2dwdc_

PDB Entry: 2dwd, 2.6 Å

PDB Description: crystal structure of kcsa-fab-tba complex in tl+

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2dwdc_:

Sequence; same for both SEQRES and ATOM records:

>d2dwdc_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d2dwdc_:

• d2dwdc_ first appeared in SCOP 1.73, called d2dwdc1
  
• d2dwdc_ appears in SCOPe 2.02
  
• d2dwdc_ appears in SCOPe 2.04
  
• d2dwdc_ appears in the current release, SCOPe 2.08