Lineage for d2dwaa_ (2dwa A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2145693Species Cow (Bos taurus) [TaxId:9913] [225036] (50 PDB entries)
  8. 2145708Domain d2dwaa_: 2dwa A: [131848]
    automated match to d1iq7a_
    complexed with co3, fe, fuc, so4, zn

Details for d2dwaa_

PDB Entry: 2dwa (more details), 2.07 Å

PDB Description: Structure of the complex of lactoferrin C-terminal half with fucose at 2.07 A resolution
PDB Compounds: (A:) lactotransferrin

SCOPe Domain Sequences for d2dwaa_:

Sequence, based on SEQRES records: (download)

>d2dwaa_ c.94.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcstsplleacaf

Sequence, based on observed residues (ATOM records): (download)

>d2dwaa_ c.94.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcsleacaf

SCOPe Domain Coordinates for d2dwaa_:

Click to download the PDB-style file with coordinates for d2dwaa_.
(The format of our PDB-style files is described here.)

Timeline for d2dwaa_: