Lineage for d2dw7n1 (2dw7 N:143-389)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 684589Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 684647Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins)
  6. 684695Protein Hypothetical protein Bll6730 [117384] (1 species)
  7. 684696Species Bradyrhizobium japonicum [TaxId:375] [117385] (3 PDB entries)
  8. 684716Domain d2dw7n1: 2dw7 N:143-389 [131842]
    Other proteins in same PDB: d2dw7a2, d2dw7b2, d2dw7c2, d2dw7d2, d2dw7e2, d2dw7f2, d2dw7g2, d2dw7h2, d2dw7i2, d2dw7j2, d2dw7k2, d2dw7l2, d2dw7m2, d2dw7n2, d2dw7o2, d2dw7p2
    automatically matched to d1tzza1
    complexed with mg, srt

Details for d2dw7n1

PDB Entry: 2dw7 (more details), 2.5 Å

PDB Description: Crystal structure of D-tartrate dehydratase from Bradyrhizobium japonicum complexed with Mg++ and meso-tartrate
PDB Compounds: (N:) Bll6730 protein

SCOP Domain Sequences for d2dw7n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dw7n1 c.1.11.2 (N:143-389) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]}
kanprvfvyaaggyyypgkglsmlrgemrgyldrgynvvkmkiggapieedrmrieavle
eigkdaqlavdangrfnletgiayakmlrdyplfwyeevgdpldyalqaalaefypgpma
tgenlfshqdarnllryggmrpdrdwlqfdcalsyglceyqrtlevlkthgwspsrciph
gghqmslniaaglglggnesypdlfqpyggfpdgvrvenghitmpdlpgigfegksdlyk
emkalae

SCOP Domain Coordinates for d2dw7n1:

Click to download the PDB-style file with coordinates for d2dw7n1.
(The format of our PDB-style files is described here.)

Timeline for d2dw7n1: