Lineage for d2dw7g1 (2dw7 G:143-389)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1573508Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1573610Family c.1.11.2: D-glucarate dehydratase-like [51609] (14 proteins)
  6. 1573780Protein automated matches [226997] (7 species)
    not a true protein
  7. Species Bradyrhizobium japonicum [TaxId:375] [255123] (2 PDB entries)
  8. 1573808Domain d2dw7g1: 2dw7 G:143-389 [131828]
    Other proteins in same PDB: d2dw7a2, d2dw7b2, d2dw7c2, d2dw7d2, d2dw7e2, d2dw7f2, d2dw7g2, d2dw7h2, d2dw7i2, d2dw7j2, d2dw7k2, d2dw7l2, d2dw7m2, d2dw7n2, d2dw7o2, d2dw7p2
    automated match to d1tzza1
    complexed with mg, srt

Details for d2dw7g1

PDB Entry: 2dw7 (more details), 2.5 Å

PDB Description: Crystal structure of D-tartrate dehydratase from Bradyrhizobium japonicum complexed with Mg++ and meso-tartrate
PDB Compounds: (G:) Bll6730 protein

SCOPe Domain Sequences for d2dw7g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dw7g1 c.1.11.2 (G:143-389) automated matches {Bradyrhizobium japonicum [TaxId: 375]}
kanprvfvyaaggyyypgkglsmlrgemrgyldrgynvvkmkiggapieedrmrieavle
eigkdaqlavdangrfnletgiayakmlrdyplfwyeevgdpldyalqaalaefypgpma
tgenlfshqdarnllryggmrpdrdwlqfdcalsyglceyqrtlevlkthgwspsrciph
gghqmslniaaglglggnesypdlfqpyggfpdgvrvenghitmpdlpgigfegksdlyk
emkalae

SCOPe Domain Coordinates for d2dw7g1:

Click to download the PDB-style file with coordinates for d2dw7g1.
(The format of our PDB-style files is described here.)

Timeline for d2dw7g1: