Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
Protein automated matches [226997] (13 species) not a true protein |
Domain d2dw7d1: 2dw7 D:143-389 [131822] Other proteins in same PDB: d2dw7a2, d2dw7b2, d2dw7c2, d2dw7d2, d2dw7e2, d2dw7f2, d2dw7g2, d2dw7h2, d2dw7i2, d2dw7j2, d2dw7k2, d2dw7l2, d2dw7m2, d2dw7n2, d2dw7o2, d2dw7p2 automated match to d1tzza1 complexed with mg, srt |
PDB Entry: 2dw7 (more details), 2.5 Å
SCOPe Domain Sequences for d2dw7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dw7d1 c.1.11.2 (D:143-389) automated matches {Bradyrhizobium japonicum [TaxId: 375]} kanprvfvyaaggyyypgkglsmlrgemrgyldrgynvvkmkiggapieedrmrieavle eigkdaqlavdangrfnletgiayakmlrdyplfwyeevgdpldyalqaalaefypgpma tgenlfshqdarnllryggmrpdrdwlqfdcalsyglceyqrtlevlkthgwspsrciph gghqmslniaaglglggnesypdlfqpyggfpdgvrvenghitmpdlpgigfegksdlyk emkalae
Timeline for d2dw7d1:
View in 3D Domains from other chains: (mouse over for more information) d2dw7a1, d2dw7a2, d2dw7b1, d2dw7b2, d2dw7c1, d2dw7c2, d2dw7e1, d2dw7e2, d2dw7f1, d2dw7f2, d2dw7g1, d2dw7g2, d2dw7h1, d2dw7h2, d2dw7i1, d2dw7i2, d2dw7j1, d2dw7j2, d2dw7k1, d2dw7k2, d2dw7l1, d2dw7l2, d2dw7m1, d2dw7m2, d2dw7n1, d2dw7n2, d2dw7o1, d2dw7o2, d2dw7p1, d2dw7p2 |