SCOPe 2.08: Domain d2dw7d1: 2dw7 D:143-389

Lineage for d2dw7d1 (2dw7 D:143-389)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)

6. Protein automated matches [226997] (13 species)
   not a true protein

7. Species Bradyrhizobium japonicum [TaxId:375] [255123] (2 PDB entries)

8. Domain d2dw7d1: 2dw7 D:143-389 [131822]
   Other proteins in same PDB: d2dw7a2, d2dw7b2, d2dw7c2, d2dw7d2, d2dw7e2, d2dw7f2, d2dw7g2, d2dw7h2, d2dw7i2, d2dw7j2, d2dw7k2, d2dw7l2, d2dw7m2, d2dw7n2, d2dw7o2, d2dw7p2
   automated match to d1tzza1
   complexed with mg, srt

Details for d2dw7d1

PDB Entry: 2dw7, 2.5 Å

PDB Description: Crystal structure of D-tartrate dehydratase from Bradyrhizobium japonicum complexed with Mg++ and meso-tartrate

PDB Compounds: (D:) Bll6730 protein

SCOPe Domain Sequences for d2dw7d1:

Sequence; same for both SEQRES and ATOM records:

>d2dw7d1 c.1.11.2 (D:143-389) automated matches {Bradyrhizobium japonicum [TaxId: 375]}
kanprvfvyaaggyyypgkglsmlrgemrgyldrgynvvkmkiggapieedrmrieavle
eigkdaqlavdangrfnletgiayakmlrdyplfwyeevgdpldyalqaalaefypgpma
tgenlfshqdarnllryggmrpdrdwlqfdcalsyglceyqrtlevlkthgwspsrciph
gghqmslniaaglglggnesypdlfqpyggfpdgvrvenghitmpdlpgigfegksdlyk
emkalae

Timeline for d2dw7d1:

• d2dw7d1 first appeared in SCOP 1.73
  
• d2dw7d1 appears in SCOPe 2.07