Lineage for d2dw6d2 (2dw6 D:2-142)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. Species Bradyrhizobium japonicum [TaxId:375] [255122] (2 PDB entries)
  8. 2554898Domain d2dw6d2: 2dw6 D:2-142 [131815]
    Other proteins in same PDB: d2dw6a1, d2dw6b1, d2dw6c1, d2dw6d1
    automated match to d1tzza2
    complexed with mg, tar, tla; mutant

Details for d2dw6d2

PDB Entry: 2dw6 (more details), 2.3 Å

PDB Description: crystal structure of the mutant k184a of d-tartrate dehydratase from bradyrhizobium japonicum complexed with mg++ and d-tartrate
PDB Compounds: (D:) Bll6730 protein

SCOPe Domain Sequences for d2dw6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dw6d2 d.54.1.0 (D:2-142) automated matches {Bradyrhizobium japonicum [TaxId: 375]}
svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
davakiagkplfrllaerhgv

SCOPe Domain Coordinates for d2dw6d2:

Click to download the PDB-style file with coordinates for d2dw6d2.
(The format of our PDB-style files is described here.)

Timeline for d2dw6d2: