Lineage for d2dw6d2 (2dw6 D:2-142)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722893Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 722894Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 722895Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 722999Protein Hypothetical protein Bll6730 [117927] (1 species)
  7. 723000Species Bradyrhizobium japonicum [TaxId:375] [117928] (3 PDB entries)
  8. 723006Domain d2dw6d2: 2dw6 D:2-142 [131815]
    Other proteins in same PDB: d2dw6a1, d2dw6b1, d2dw6c1, d2dw6d1
    automatically matched to d1tzzb2
    complexed with mg, tar, tla; mutant

Details for d2dw6d2

PDB Entry: 2dw6 (more details), 2.3 Å

PDB Description: crystal structure of the mutant k184a of d-tartrate dehydratase from bradyrhizobium japonicum complexed with mg++ and d-tartrate
PDB Compounds: (D:) Bll6730 protein

SCOP Domain Sequences for d2dw6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dw6d2 d.54.1.1 (D:2-142) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]}
svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
davakiagkplfrllaerhgv

SCOP Domain Coordinates for d2dw6d2:

Click to download the PDB-style file with coordinates for d2dw6d2.
(The format of our PDB-style files is described here.)

Timeline for d2dw6d2: