SCOP 1.73: Domain d2dw6d2: 2dw6 D:2-142

Lineage for d2dw6d2 (2dw6 D:2-142)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Hypothetical protein Bll6730 [117927] (1 species)

7. Species Bradyrhizobium japonicum [TaxId:375] [117928] (3 PDB entries)

8. Domain d2dw6d2: 2dw6 D:2-142 [131815]
   Other proteins in same PDB: d2dw6a1, d2dw6b1, d2dw6c1, d2dw6d1
   automatically matched to d1tzzb2
   complexed with mg, tar, tla; mutant

Details for d2dw6d2

PDB Entry: 2dw6, 2.3 Å

PDB Description: crystal structure of the mutant k184a of d-tartrate dehydratase from bradyrhizobium japonicum complexed with mg++ and d-tartrate

PDB Compounds: (D:) Bll6730 protein

SCOP Domain Sequences for d2dw6d2:

Sequence; same for both SEQRES and ATOM records:

>d2dw6d2 d.54.1.1 (D:2-142) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]}
svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
davakiagkplfrllaerhgv

Timeline for d2dw6d2:

• d2dw6d2 is new in SCOP 1.73
  
• d2dw6d2 appears in SCOP 1.75
  
• d2dw6d2 appears in the current release, SCOPe 2.08