Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) |
Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins) C-terminal domain is beta/alpha-barrel |
Protein Hypothetical protein Bll6730 [117927] (1 species) |
Species Bradyrhizobium japonicum [TaxId:375] [117928] (3 PDB entries) |
Domain d2dw6c2: 2dw6 C:2-142 [131813] Other proteins in same PDB: d2dw6a1, d2dw6b1, d2dw6c1, d2dw6d1 automatically matched to d1tzzb2 complexed with mg, tar, tla; mutant |
PDB Entry: 2dw6 (more details), 2.3 Å
SCOP Domain Sequences for d2dw6c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dw6c2 d.54.1.1 (C:2-142) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw davakiagkplfrllaerhgv
Timeline for d2dw6c2: