SCOP 1.73: Domain d2dw6c1: 2dw6 C:143-389

Lineage for d2dw6c1 (2dw6 C:143-389)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins)

6. Protein Hypothetical protein Bll6730 [117384] (1 species)

7. Species Bradyrhizobium japonicum [TaxId:375] [117385] (3 PDB entries)

8. Domain d2dw6c1: 2dw6 C:143-389 [131812]
   Other proteins in same PDB: d2dw6a2, d2dw6b2, d2dw6c2, d2dw6d2
   automatically matched to d1tzza1
   complexed with mg, tar, tla; mutant

Details for d2dw6c1

PDB Entry: 2dw6, 2.3 Å

PDB Description: Crystal structure of the mutant K184A of D-Tartrate Dehydratase from Bradyrhizobium japonicum complexed with Mg++ and D-tartrate

PDB Compounds: (C:) Bll6730 protein

SCOP Domain Sequences for d2dw6c1:

Sequence; same for both SEQRES and ATOM records:

>d2dw6c1 c.1.11.2 (C:143-389) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]}
kanprvfvyaaggyyypgkglsmlrgemrgyldrgynvvkmaiggapieedrmrieavle
eigkdaqlavdangrfnletgiayakmlrdyplfwyeevgdpldyalqaalaefypgpma
tgenlfshqdarnllryggmrpdrdwlqfdcalsyglceyqrtlevlkthgwspsrciph
gghqmslniaaglglggnesypdlfqpyggfpdgvrvenghitmpdlpgigfegksdlyk
emkalae

Timeline for d2dw6c1:

• d2dw6c1 is new in SCOP 1.73
  
• d2dw6c1 appears in SCOP 1.75
  
• d2dw6c1 appears in the current release, SCOPe 2.08