![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins) |
![]() | Protein Hypothetical protein Bll6730 [117384] (1 species) |
![]() | Species Bradyrhizobium japonicum [TaxId:375] [117385] (3 PDB entries) |
![]() | Domain d2dw6c1: 2dw6 C:143-389 [131812] Other proteins in same PDB: d2dw6a2, d2dw6b2, d2dw6c2, d2dw6d2 automatically matched to d1tzza1 complexed with mg, tar, tla; mutant |
PDB Entry: 2dw6 (more details), 2.3 Å
SCOP Domain Sequences for d2dw6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dw6c1 c.1.11.2 (C:143-389) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} kanprvfvyaaggyyypgkglsmlrgemrgyldrgynvvkmaiggapieedrmrieavle eigkdaqlavdangrfnletgiayakmlrdyplfwyeevgdpldyalqaalaefypgpma tgenlfshqdarnllryggmrpdrdwlqfdcalsyglceyqrtlevlkthgwspsrciph gghqmslniaaglglggnesypdlfqpyggfpdgvrvenghitmpdlpgigfegksdlyk emkalae
Timeline for d2dw6c1: