Lineage for d2dw5a1 (2dw5 A:113-293)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1301391Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (1 family) (S)
    automatically mapped to Pfam PF08527
  5. 1301392Family b.2.9.1: Peptidylarginine deiminase Pad4, middle domain [110084] (1 protein)
  6. 1301393Protein Peptidylarginine deiminase Pad4, middle domain [110085] (1 species)
  7. 1301394Species Human (Homo sapiens) [TaxId:9606] [110086] (7 PDB entries)
    Uniprot Q9UM07
  8. 1301398Domain d2dw5a1: 2dw5 A:113-293 [131805]
    Other proteins in same PDB: d2dw5a2, d2dw5a3
    automatically matched to d1wd8a1
    complexed with bfb, ca, so4

Details for d2dw5a1

PDB Entry: 2dw5 (more details), 2.3 Å

PDB Description: Crystal structure of human peptidylarginine deiminase 4 in complex with N-alpha-benzoyl-N5-(2-fluoro-1-iminoethyl)-L-ornithine amide
PDB Compounds: (A:) Protein-arginine deiminase type-4

SCOPe Domain Sequences for d2dw5a1:

Sequence, based on SEQRES records: (download)

>d2dw5a1 b.2.9.1 (A:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]}
veislcaditrtgkvkptravkdqrtwtwgpcgqgaillvncdrdnlessamdceddevl
dsedlqdmslmtlstktpkdfftnhtlvlhvarsemdkvrvfqatrgklsskcsvvlgpk
wpshylmvpggkhnmdfyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfr
v

Sequence, based on observed residues (ATOM records): (download)

>d2dw5a1 b.2.9.1 (A:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]}
veislcaditrtgkqrtwtwgpcgqgaillvncdrdnlessamdceddevldsedlqdms
lmtlstktpkdfftnhtlvlhvarsemdkvrvfqatcsvvlgpkwpshylmvpggkhnmd
fyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfrv

SCOPe Domain Coordinates for d2dw5a1:

Click to download the PDB-style file with coordinates for d2dw5a1.
(The format of our PDB-style files is described here.)

Timeline for d2dw5a1: