SCOP 1.73: Domain d2dvxb1: 2dvx B:1-324

Lineage for d2dvxb1 (2dvx B:1-324)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.15: PP1699/LP2961-like [141819] (5 proteins)
   Pfam PF04909; Amidohydrolase; stand-alone domain

6. Protein Thermophilic reversible gamma-resorcylate decarboxylase [141822] (1 species)

7. Species Rhizobium sp. MTP-10005 [TaxId:267998] [141823] (3 PDB entries)

8. Domain d2dvxb1: 2dvx B:1-324 [131802]
   automatically matched to 2DVT A:1-325
   complexed with 23a, zn

Details for d2dvxb1

PDB Entry: 2dvx, 1.7 Å

PDB Description: Crystal Structure of 2,6-Dihydroxybenzoate Decarboxylase Complexed with inhibitor 2,3-dihydroxybenzaldehyde

PDB Compounds: (B:) Thermophilic reversible gamma-resorcylate decarboxylase

SCOP Domain Sequences for d2dvxb1:

Sequence; same for both SEQRES and ATOM records:

>d2dvxb1 c.1.9.15 (B:1-324) Thermophilic reversible gamma-resorcylate decarboxylase {Rhizobium sp. MTP-10005 [TaxId: 267998]}
mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
natsiaeadrvkigrtnarrlfkl

Timeline for d2dvxb1:

• d2dvxb1 is new in SCOP 1.73
  
• d2dvxb1 appears in SCOP 1.75
  
• d2dvxb1 appears in the current release, SCOPe 2.08, called d2dvxb_