SCOPe 2.05: Domain d2dvub_: 2dvu B:

Lineage for d2dvub_ (2dvu B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins)
   Pfam PF04909; Amidohydrolase; stand-alone domain

6. Protein Thermophilic reversible gamma-resorcylate decarboxylase [141822] (1 species)

7. Species Rhizobium sp. MTP-10005 [TaxId:267998] [141823] (3 PDB entries)
   Uniprot Q60GU1 1-325

8. Domain d2dvub_: 2dvu B: [131798]
   automated match to d2dvta1
   complexed with gre, zn

Details for d2dvub_

PDB Entry: 2dvu, 1.9 Å

PDB Description: Crystal Structure of 2,6-Dihydroxybenzoate Decarboxylase Complexed with 2,6-Dihydroxybenzoate

PDB Compounds: (B:) Thermophilic reversible gamma-resorcylate decarboxylase

SCOPe Domain Sequences for d2dvub_:

Sequence; same for both SEQRES and ATOM records:

>d2dvub_ c.1.9.15 (B:) Thermophilic reversible gamma-resorcylate decarboxylase {Rhizobium sp. MTP-10005 [TaxId: 267998]}
mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
natsiaeadrvkigrtnarrlfkl

Timeline for d2dvub_:

• d2dvub_ first appeared in SCOP 1.73, called d2dvub1
  
• d2dvub_ appears in SCOPe 2.04
  
• d2dvub_ appears in SCOPe 2.06
  
• d2dvub_ appears in the current release, SCOPe 2.08