Lineage for d2dvua1 (2dvu A:1-325)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683612Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 683885Family c.1.9.15: PP1699/LP2961-like [141819] (5 proteins)
    Pfam PF04909; Amidohydrolase; stand-alone domain
  6. 683904Protein Thermophilic reversible gamma-resorcylate decarboxylase [141822] (1 species)
  7. 683905Species Rhizobium sp. MTP-10005 [TaxId:267998] [141823] (3 PDB entries)
  8. 683914Domain d2dvua1: 2dvu A:1-325 [131797]
    automatically matched to 2DVT A:1-325
    complexed with gre, zn

Details for d2dvua1

PDB Entry: 2dvu (more details), 1.9 Å

PDB Description: Crystal Structure of 2,6-Dihydroxybenzoate Decarboxylase Complexed with 2,6-Dihydroxybenzoate
PDB Compounds: (A:) Thermophilic reversible gamma-resorcylate decarboxylase

SCOP Domain Sequences for d2dvua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dvua1 c.1.9.15 (A:1-325) Thermophilic reversible gamma-resorcylate decarboxylase {Rhizobium sp. MTP-10005 [TaxId: 267998]}
mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
natsiaeadrvkigrtnarrlfkld

SCOP Domain Coordinates for d2dvua1:

Click to download the PDB-style file with coordinates for d2dvua1.
(The format of our PDB-style files is described here.)

Timeline for d2dvua1: