Lineage for d2dvia2 (2dvi A:3-142)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740075Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 740076Superfamily d.218.1: Nucleotidyltransferase [81301] (11 families) (S)
  5. 740290Family d.218.1.7: Archaeal tRNA CCA-adding enzyme catalytic domain [102940] (1 protein)
    similar overall structure to poly(A) polymerase, PAP
  6. 740291Protein tRNA nucleotidyltransferase, N-terminal domain [102941] (1 species)
  7. 740292Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102942] (17 PDB entries)
  8. 740304Domain d2dvia2: 2dvi A:3-142 [131791]
    Other proteins in same PDB: d2dvia1, d2dvia3
    automatically matched to d1r89a2
    complexed with ctp, mg, so4

Details for d2dvia2

PDB Entry: 2dvi (more details), 2.61 Å

PDB Description: Complex structure of CCA-adding enzyme, mini-DCC and CTP
PDB Compounds: (A:) CCA-adding enzyme

SCOP Domain Sequences for d2dvia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dvia2 d.218.1.7 (A:3-142) tRNA nucleotidyltransferase, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
veeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgsleidv
fllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkepkn
iksavdrtpfhhkwlegrik

SCOP Domain Coordinates for d2dvia2:

Click to download the PDB-style file with coordinates for d2dvia2.
(The format of our PDB-style files is described here.)

Timeline for d2dvia2: