Lineage for d2dvgc1 (2dvg C:1-232)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663507Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (23 PDB entries)
  8. 663582Domain d2dvgc1: 2dvg C:1-232 [131788]
    automatically matched to d1bzwa_
    complexed with ca, gal, glc, mn, so4

Details for d2dvgc1

PDB Entry: 2dvg (more details), 2.78 Å

PDB Description: crystal structure of peanut lectin gal-alpha-1,6-glc complex
PDB Compounds: (C:) Galactose-binding lectin

SCOP Domain Sequences for d2dvgc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dvgc1 b.29.1.1 (C:1-232) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOP Domain Coordinates for d2dvgc1:

Click to download the PDB-style file with coordinates for d2dvgc1.
(The format of our PDB-style files is described here.)

Timeline for d2dvgc1: