Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein Legume lectin [49904] (23 species) |
Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (30 PDB entries) Uniprot P02872 24-255 |
Domain d2dvgb_: 2dvg B: [131787] automated match to d1bzwa_ complexed with ca, gla, mn, so4 |
PDB Entry: 2dvg (more details), 2.78 Å
SCOPe Domain Sequences for d2dvgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dvgb_ b.29.1.1 (B:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
Timeline for d2dvgb_: