SCOPe 2.03: Domain d2dvfb_: 2dvf B:

Lineage for d2dvfb_ (2dvf B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (23 PDB entries)
   Uniprot P02872 24-255

8. Domain d2dvfb_: 2dvf B: [131783]
   automated match to d1bzwa_
   complexed with ca, mn, so4

Details for d2dvfb_

PDB Entry: 2dvf, 2.74 Å

PDB Description: crystals of peanut lectin grown in the presence of gal-alpha-1,3-gal-beta-1,4-gal

PDB Compounds: (B:) Galactose-binding lectin

SCOPe Domain Sequences for d2dvfb_:

Sequence; same for both SEQRES and ATOM records:

>d2dvfb_ b.29.1.1 (B:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

Timeline for d2dvfb_:

• d2dvfb_ first appeared in SCOP 1.73, called d2dvfb1
  
• d2dvfb_ appears in SCOPe 2.02
  
• d2dvfb_ appears in SCOPe 2.04
  
• d2dvfb_ appears in the current release, SCOPe 2.08