Lineage for d2dvfa_ (2dvf A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2387950Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2388157Protein Legume lectin [49904] (23 species)
  7. 2388337Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (30 PDB entries)
    Uniprot P02872 24-255
  8. 2388405Domain d2dvfa_: 2dvf A: [131782]
    automated match to d1bzwa_
    complexed with ca, mn, so4

Details for d2dvfa_

PDB Entry: 2dvf (more details), 2.74 Å

PDB Description: crystals of peanut lectin grown in the presence of gal-alpha-1,3-gal-beta-1,4-gal
PDB Compounds: (A:) Galactose-binding lectin

SCOPe Domain Sequences for d2dvfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dvfa_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOPe Domain Coordinates for d2dvfa_:

Click to download the PDB-style file with coordinates for d2dvfa_.
(The format of our PDB-style files is described here.)

Timeline for d2dvfa_: