SCOP 1.73: Domain d2dvda1: 2dvd A:1-232

Lineage for d2dvda1 (2dvd A:1-232)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (23 PDB entries)

8. Domain d2dvda1: 2dvd A:1-232 [131778]
   automatically matched to d1bzwa_
   complexed with ca, gal, mn, so4

Details for d2dvda1

PDB Entry: 2dvd, 2.25 Å

PDB Description: crystal structure of peanut lectin gal-alpha-1,3-gal complex

PDB Compounds: (A:) Galactose-binding lectin

SCOP Domain Sequences for d2dvda1:

Sequence; same for both SEQRES and ATOM records:

>d2dvda1 b.29.1.1 (A:1-232) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

Timeline for d2dvda1:

• d2dvda1 is new in SCOP 1.73
  
• d2dvda1 appears in SCOP 1.75
  
• d2dvda1 appears in the current release, SCOPe 2.08, called d2dvda_