Lineage for d2dv1b2 (2dv1 B:441-748)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644948Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 644949Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 645271Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 645272Protein Catalase-peroxidase KatG [74754] (4 species)
    only the N-terminal CCP-like domain binds heme
  7. 645278Species Burkholderia pseudomallei [TaxId:28450] [89093] (14 PDB entries)
  8. 645286Domain d2dv1b2: 2dv1 B:441-748 [131759]
    automatically matched to d1mwva2
    complexed with hem, mpd, na, po4; mutant

Details for d2dv1b2

PDB Entry: 2dv1 (more details), 1.8 Å

PDB Description: crystal structure of d141e mutant of bpkatg
PDB Compounds: (B:) Peroxidase/catalase

SCOP Domain Sequences for d2dv1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dv1b2 a.93.1.3 (B:441-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
nldrfdla

SCOP Domain Coordinates for d2dv1b2:

Click to download the PDB-style file with coordinates for d2dv1b2.
(The format of our PDB-style files is described here.)

Timeline for d2dv1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dv1b1