Lineage for d2dv1b1 (2dv1 B:35-443)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496989Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1496990Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1497460Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 proteins)
    duplication: tandem repeat of two CCP-like domains
  6. 1497461Protein Catalase-peroxidase KatG [74754] (4 species)
    only the N-terminal CCP-like domain binds heme
  7. 1497462Species Burkholderia pseudomallei [TaxId:28450] [89093] (21 PDB entries)
    Uniprot P13029 Q939D2 35-748
  8. 1497481Domain d2dv1b1: 2dv1 B:35-443 [131758]
    automated match to d1sj2a1
    complexed with hem, mpd, na, po4; mutant

Details for d2dv1b1

PDB Entry: 2dv1 (more details), 1.8 Å

PDB Description: crystal structure of d141e mutant of bpkatg
PDB Compounds: (B:) Peroxidase/catalase

SCOPe Domain Sequences for d2dv1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dv1b1 a.93.1.3 (B:35-443) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpenanldkarrllwp
ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp
tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaev

SCOPe Domain Coordinates for d2dv1b1:

Click to download the PDB-style file with coordinates for d2dv1b1.
(The format of our PDB-style files is described here.)

Timeline for d2dv1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dv1b2