Lineage for d2dv1a1 (2dv1 A:35-440)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644948Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 644949Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 645271Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 645272Protein Catalase-peroxidase KatG [74754] (4 species)
    only the N-terminal CCP-like domain binds heme
  7. 645278Species Burkholderia pseudomallei [TaxId:28450] [89093] (14 PDB entries)
  8. 645283Domain d2dv1a1: 2dv1 A:35-440 [131756]
    automatically matched to d1mwva1
    complexed with hem, mpd, na, po4; mutant

Details for d2dv1a1

PDB Entry: 2dv1 (more details), 1.8 Å

PDB Description: crystal structure of d141e mutant of bpkatg
PDB Compounds: (A:) Peroxidase/catalase

SCOP Domain Sequences for d2dv1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dv1a1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpenanldkarrllwp
ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp
tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp

SCOP Domain Coordinates for d2dv1a1:

Click to download the PDB-style file with coordinates for d2dv1a1.
(The format of our PDB-style files is described here.)

Timeline for d2dv1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dv1a2