Lineage for d2du1a_ (2du1 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042364Protein Legume lectin [49904] (23 species)
  7. 2042672Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries)
  8. 2042695Domain d2du1a_: 2du1 A: [131745]
    automated match to d1wbfa_
    complexed with ca, mgc, mn, nag

Details for d2du1a_

PDB Entry: 2du1 (more details), 2.6 Å

PDB Description: Crystal Structure of basic winged bean lectin in complex with Methyl-alpha-N-acetyl-D galactosamine
PDB Compounds: (A:) Basic agglutinin

SCOPe Domain Sequences for d2du1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2du1a_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

SCOPe Domain Coordinates for d2du1a_:

Click to download the PDB-style file with coordinates for d2du1a_.
(The format of our PDB-style files is described here.)

Timeline for d2du1a_: