SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2du1a_ (2du1 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042364Protein Legume lectin [49904] (23 species)
  7. 2042672Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries)
  8. 2042695Domain d2du1a_: 2du1 A: [131745]
    automated match to d1wbfa_
    complexed with ca, mgc, mn, nag

Details for d2du1a_

PDB Entry: 2du1 (more details), 2.6 Å

PDB Description: Crystal Structure of basic winged bean lectin in complex with Methyl-alpha-N-acetyl-D galactosamine
PDB Compounds: (A:) Basic agglutinin

SCOPe Domain Sequences for d2du1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2du1a_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

SCOPe Domain Coordinates for d2du1a_:

Click to download the PDB-style file with coordinates for d2du1a_.
(The format of our PDB-style files is described here.)

Timeline for d2du1a_: