Lineage for d2du0d_ (2du0 D:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1118107Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1118247Protein Legume lectin [49904] (23 species)
  7. 1118553Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries)
  8. 1118591Domain d2du0d_: 2du0 D: [131744]
    automated match to d1wbfa_
    complexed with ca, gla, mn, nag

Details for d2du0d_

PDB Entry: 2du0 (more details), 2.7 Å

PDB Description: crystal structure of basic winged bean lectin in complex with alpha-d- galactose
PDB Compounds: (D:) Basic agglutinin

SCOPe Domain Sequences for d2du0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2du0d_ b.29.1.1 (D:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

SCOPe Domain Coordinates for d2du0d_:

Click to download the PDB-style file with coordinates for d2du0d_.
(The format of our PDB-style files is described here.)

Timeline for d2du0d_: