SCOPe 2.02: Domain d2du0a_: 2du0 A:

Lineage for d2du0a_ (2du0 A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries)

8. Domain d2du0a_: 2du0 A: [131741]
   automated match to d1wbfa_
   complexed with ca, gla, mn, nag

Details for d2du0a_

PDB Entry: 2du0, 2.7 Å

PDB Description: crystal structure of basic winged bean lectin in complex with alpha-d- galactose

PDB Compounds: (A:) Basic agglutinin

SCOPe Domain Sequences for d2du0a_:

Sequence; same for both SEQRES and ATOM records:

>d2du0a_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

Timeline for d2du0a_:

• d2du0a_ first appeared in SCOP 1.73, called d2du0a1
  
• d2du0a_ appears in SCOPe 2.01
  
• d2du0a_ appears in SCOPe 2.03
  
• d2du0a_ appears in the current release, SCOPe 2.08