Lineage for d2dtyc1 (2dty C:1-237)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 794082Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 794214Protein Legume lectin [49904] (23 species)
  7. 794562Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (14 PDB entries)
  8. 794607Domain d2dtyc1: 2dty C:1-237 [131739]
    automatically matched to d1wbfa_
    complexed with a2g, bma, ca, fuc, ful, mn, nag

Details for d2dtyc1

PDB Entry: 2dty (more details), 2.65 Å

PDB Description: crystal structure of basic winged bean lectin complexed with n-acetyl- d-galactosamine
PDB Compounds: (C:) Basic agglutinin

SCOP Domain Sequences for d2dtyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtyc1 b.29.1.1 (C:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

SCOP Domain Coordinates for d2dtyc1:

Click to download the PDB-style file with coordinates for d2dtyc1.
(The format of our PDB-style files is described here.)

Timeline for d2dtyc1: